Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02267.1.g00180.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 274aa    MW: 29127.6 Da    PI: 9.0999
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+ +a+++i++l+ +++++++   a++ +   +  50 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDAAQHEIDKLPPLQFPPQH---AQDLVAHLQ 127
                                   78*************************************************************999993...335555555 PP

                           TCP  84 nsssgkaaksaakskks 100
                                    +s+ +  +s+a   ++ 128 PPSILAPFTSTAAADSA 144
                                   44444333333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2651114IPR005333Transcription factor, TCP
PROSITE profilePS5136929.40251109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-144PREDICTED: transcription factor TCP13-like isoform X1
RefseqXP_004961522.11e-144PREDICTED: transcription factor TCP13-like isoform X1
RefseqXP_012700333.11e-144PREDICTED: transcription factor TCP13-like isoform X1
TrEMBLK3Z8G31e-143K3Z8G3_SETIT; Uncharacterized protein
STRINGSi022830m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number